Lineage for d1n26a3 (1n26 A:196-299)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290499Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 290500Family b.1.2.1: Fibronectin type III [49266] (20 proteins)
  6. 290672Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species)
  7. 290673Species Human (Homo sapiens) [TaxId:9606] [81978] (2 PDB entries)
  8. 290675Domain d1n26a3: 1n26 A:196-299 [79852]
    Other proteins in same PDB: d1n26a1
    complexed with cys, man, nag, so4

Details for d1n26a3

PDB Entry: 1n26 (more details), 2.4 Å

PDB Description: crystal structure of the extra-cellular domains of human interleukin-6 receptor alpha chain

SCOP Domain Sequences for d1n26a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens)}
qpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmvkdlq
hhcvihdawsglrhvvqlraqeefgqgewsewspeamgtpwtes

SCOP Domain Coordinates for d1n26a3:

Click to download the PDB-style file with coordinates for d1n26a3.
(The format of our PDB-style files is described here.)

Timeline for d1n26a3: