Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81978] (2 PDB entries) |
Domain d1n26a2: 1n26 A:94-195 [79851] Other proteins in same PDB: d1n26a1 complexed with cys, nag, so4 |
PDB Entry: 1n26 (more details), 2.4 Å
SCOPe Domain Sequences for d1n26a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n26a2 b.1.2.1 (A:94-195) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} ppeepqlscfrksplsnvvcewgprstpslttkavllvrkfqnspaedfqepcqysqesq kfscqlavpegdssfyivsmcvassvgskfsktqtfqgcgil
Timeline for d1n26a2: