Lineage for d1n26a2 (1n26 A:94-195)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 935729Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 935730Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 936056Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species)
  7. 936057Species Human (Homo sapiens) [TaxId:9606] [81978] (3 PDB entries)
  8. 936058Domain d1n26a2: 1n26 A:94-195 [79851]
    Other proteins in same PDB: d1n26a1
    complexed with cys, nag, so4

Details for d1n26a2

PDB Entry: 1n26 (more details), 2.4 Å

PDB Description: Crystal Structure of the extra-cellular domains of Human Interleukin-6 Receptor alpha chain
PDB Compounds: (A:) IL-6 Receptor alpha chain

SCOPe Domain Sequences for d1n26a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n26a2 b.1.2.1 (A:94-195) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
ppeepqlscfrksplsnvvcewgprstpslttkavllvrkfqnspaedfqepcqysqesq
kfscqlavpegdssfyivsmcvassvgskfsktqtfqgcgil

SCOPe Domain Coordinates for d1n26a2:

Click to download the PDB-style file with coordinates for d1n26a2.
(The format of our PDB-style files is described here.)

Timeline for d1n26a2: