| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (20 proteins) |
| Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [81978] (2 PDB entries) |
| Domain d1n26a2: 1n26 A:94-195 [79851] Other proteins in same PDB: d1n26a1 |
PDB Entry: 1n26 (more details), 2.4 Å
SCOP Domain Sequences for d1n26a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n26a2 b.1.2.1 (A:94-195) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens)}
ppeepqlscfrksplsnvvcewgprstpslttkavllvrkfqnspaedfqepcqysqesq
kfscqlavpegdssfyivsmcvassvgskfsktqtfqgcgil
Timeline for d1n26a2: