Lineage for d1n26a2 (1n26 A:94-195)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290499Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 290500Family b.1.2.1: Fibronectin type III [49266] (20 proteins)
  6. 290672Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species)
  7. 290673Species Human (Homo sapiens) [TaxId:9606] [81978] (2 PDB entries)
  8. 290674Domain d1n26a2: 1n26 A:94-195 [79851]
    Other proteins in same PDB: d1n26a1

Details for d1n26a2

PDB Entry: 1n26 (more details), 2.4 Å

PDB Description: crystal structure of the extra-cellular domains of human interleukin-6 receptor alpha chain

SCOP Domain Sequences for d1n26a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n26a2 b.1.2.1 (A:94-195) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens)}
ppeepqlscfrksplsnvvcewgprstpslttkavllvrkfqnspaedfqepcqysqesq
kfscqlavpegdssfyivsmcvassvgskfsktqtfqgcgil

SCOP Domain Coordinates for d1n26a2:

Click to download the PDB-style file with coordinates for d1n26a2.
(The format of our PDB-style files is described here.)

Timeline for d1n26a2: