Lineage for d1n26a1 (1n26 A:1-93)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 290223Family b.1.1.4: I set domains [49159] (29 proteins)
  6. 290364Protein Interleukin-6 receptor alpha chain, N-teminal domain [81958] (1 species)
  7. 290365Species Human (Homo sapiens) [TaxId:9606] [81959] (1 PDB entry)
  8. 290366Domain d1n26a1: 1n26 A:1-93 [79850]
    Other proteins in same PDB: d1n26a2, d1n26a3
    complexed with cys, man, nag, so4

Details for d1n26a1

PDB Entry: 1n26 (more details), 2.4 Å

PDB Description: crystal structure of the extra-cellular domains of human interleukin-6 receptor alpha chain

SCOP Domain Sequences for d1n26a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-teminal domain {Human (Homo sapiens)}
laprrcpaqevargvltslpgdsvtltcpgvepednatvhwvlrkpaagshpsrwagmgr
rlllrsvqlhdsgnyscyragrpagtvhllvdv

SCOP Domain Coordinates for d1n26a1:

Click to download the PDB-style file with coordinates for d1n26a1.
(The format of our PDB-style files is described here.)

Timeline for d1n26a1: