Lineage for d1n24a2 (1n24 A:271-598)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281954Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1281955Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1282079Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (3 proteins)
    automatically mapped to Pfam PF03936
  6. 1282080Protein (+)-bornyl diphosphate synthase [81920] (1 species)
  7. 1282081Species Garden sage (Salvia officinalis) [TaxId:38868] [81921] (7 PDB entries)
  8. 1282086Domain d1n24a2: 1n24 A:271-598 [79847]
    Other proteins in same PDB: d1n24a1, d1n24b1
    complexed with bp2, mg

Details for d1n24a2

PDB Entry: 1n24 (more details), 2.3 Å

PDB Description: (+)-Bornyl diphosphate synthase: Complex with Mg and product
PDB Compounds: (A:) (+)-bornyl diphosphate synthase

SCOPe Domain Sequences for d1n24a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n24a2 a.128.1.3 (A:271-598) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]}
mnplifelaklnfniiqathqqelkdlsrwwsrlcfpeklpfvrdrlvesffwavgmfep
hqhgyqrkmaatiivlatviddiydvygtldelelftdtfkrwdtesitrlpyymqlcyw
gvhnyisdaaydilkehgffclqylrksvvdlveayfheakwyhsgytpsldeylniaki
svaspaiisptyftfanashdtavidslyqyhdilclagiilrlpddlgtsyfelargdv
pktiqcymketnaseeeavehvkflireawkdmntaiaagypfpdgmvagaanigrvaqf
iylhgdgfgvqhsktyehiagllfepya

SCOPe Domain Coordinates for d1n24a2:

Click to download the PDB-style file with coordinates for d1n24a2.
(The format of our PDB-style files is described here.)

Timeline for d1n24a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n24a1