SCOPe 2.05: Domain d1n24a1: 1n24 A:54-270

Lineage for d1n24a1 (1n24 A:54-270)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins)
   incomplete toroid made of four hairpins
   automatically mapped to Pfam PF01397

6. Protein (+)-bornyl diphosphate synthase [81857] (1 species)

7. Species Garden sage (Salvia officinalis) [TaxId:38868] [81858] (7 PDB entries)

8. Domain d1n24a1: 1n24 A:54-270 [79846]
   Other proteins in same PDB: d1n24a2, d1n24b2
   complexed with bp2, mg

Details for d1n24a1

PDB Entry: 1n24, 2.3 Å

PDB Description: (+)-Bornyl diphosphate synthase: Complex with Mg and product

PDB Compounds: (A:) (+)-bornyl diphosphate synthase

SCOPe Domain Sequences for d1n24a1:

Sequence, based on SEQRES records:

>d1n24a1 a.102.4.1 (A:54-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]}
irrsgnyqpalwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdl
kylglsdffqdeikeilgviynehkcfhnnevekmdlyftalgfrllrqhgfnisqdvfn
cfknekgidfkaslaqdtkgmlqlyeasfllrkgedtlelarefatkclqkkldeggnei
denlllwirhsldlplhwriqsvearwfidayarrpd

Sequence, based on observed residues (ATOM records):

>d1n24a1 a.102.4.1 (A:54-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]}
irrsgnyqpalwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdl
kylglsdffqdeikeilgviynehkcfhdlyftalgfrllrqhgfnisqdvfncfknekg
idfkaslaqdtkgmlqlyeasfllrkgedtlelarefatkclqkkldeidenlllwirhs
ldlplhwriqsvearwfidayarrpd

Timeline for d1n24a1:

• d1n24a1 first appeared in SCOP 1.63
  
• d1n24a1 appears in SCOPe 2.04
  
• d1n24a1 appears in SCOPe 2.06
  
• d1n24a1 appears in the current release, SCOPe 2.08