SCOPe 2.03: Domain d1n23b1: 1n23 B:61-270

Lineage for d1n23b1 (1n23 B:61-270)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins)
   incomplete toroid made of four hairpins
   automatically mapped to Pfam PF01397

6. Protein (+)-bornyl diphosphate synthase [81857] (1 species)

7. Species Garden sage (Salvia officinalis) [TaxId:38868] [81858] (7 PDB entries)

8. Domain d1n23b1: 1n23 B:61-270 [79844]
   Other proteins in same PDB: d1n23a2, d1n23b2
   complexed with 2bn, mg, pop

Details for d1n23b1

PDB Entry: 1n23, 2.4 Å

PDB Description: (+)-Bornyl diphosphate synthase: Complex with Mg, pyrophosphate, and (1R,4S)-2-azabornane

PDB Compounds: (B:) (+)-bornyl diphosphate synthase

SCOPe Domain Sequences for d1n23b1:

Sequence, based on SEQRES records:

>d1n23b1 a.102.4.1 (B:61-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]}
qpalwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsd
ffqdeikeilgviynehkcfhnnevekmdlyftalgfrllrqhgfnisqdvfncfknekg
idfkaslaqdtkgmlqlyeasfllrkgedtlelarefatkclqkkldeggneidenlllw
irhsldlplhwriqsvearwfidayarrpd

Sequence, based on observed residues (ATOM records):

>d1n23b1 a.102.4.1 (B:61-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]}
qpalwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsd
ffqdeikeilgviynehkcdlyftalgfrllrqhgfnisqdvfncfknekgidfkaslaq
dtkgmlqlyeasfllrkgedtlelarefatkclqkkldeneidenlllwirhsldlplhw
riqsvearwfidayarrpd

Timeline for d1n23b1:

• d1n23b1 first appeared in SCOP 1.63
  
• d1n23b1 appears in SCOPe 2.02
  
• d1n23b1 appears in SCOPe 2.04
  
• d1n23b1 appears in the current release, SCOPe 2.08