SCOP 1.65: Domain d1n22b1: 1n22 B:64-270

Lineage for d1n22b1 (1n22 B:64-270)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array

4. Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.1: Terpenoid cylase N-terminal domain [48240] (2 proteins)
   incomlete toroid made of four haipins

6. Protein (+)-bornyl diphosphate synthase [81857] (1 species)

7. Species Garden sage (Salvia officinalis) [TaxId:38868] [81858] (7 PDB entries)

8. Domain d1n22b1: 1n22 B:64-270 [79840]
   Other proteins in same PDB: d1n22a2, d1n22b2
   complexed with 7a8, mg, pop

Details for d1n22b1

PDB Entry: 1n22, 2.4 Å

PDB Description: (+)-Bornyl Diphosphate Synthase: Complex with Mg, pyrophosphate, and (4R)-7-aza-7,8-dihydrolimonene

SCOP Domain Sequences for d1n22b1:

Sequence, based on SEQRES records:

>d1n22b1 a.102.4.1 (B:64-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis)}
lwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsdffq
deikeilgviynehkcfhnnevekmdlyftalgfrllrqhgfnisqdvfncfknekgidf
kaslaqdtkgmlqlyeasfllrkgedtlelarefatkclqkkldeggneidenlllwirh
sldlplhwriqsvearwfidayarrpd

Sequence, based on observed residues (ATOM records):

>d1n22b1 a.102.4.1 (B:64-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis)}
lwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsdffq
deikeilgviynehkcfhmdlyftalgfrllrqhgfnisqdvfncfknekgidfkaslaq
dtkgmlqlyeasfllrkgedtlelarefatkclqkkldeneidenlllwirhsldlplhw
riqsvearwfidayarrpd

Timeline for d1n22b1:

• d1n22b1 first appeared in SCOP 1.63
  
• d1n22b1 appears in SCOP 1.67
  
• d1n22b1 appears in the current release, SCOPe 2.08