Lineage for d1n20b1 (1n20 B:61-270)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276995Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1276996Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins)
    incomplete toroid made of four hairpins
    automatically mapped to Pfam PF01397
  6. 1276997Protein (+)-bornyl diphosphate synthase [81857] (1 species)
  7. 1276998Species Garden sage (Salvia officinalis) [TaxId:38868] [81858] (7 PDB entries)
  8. 1277002Domain d1n20b1: 1n20 B:61-270 [79834]
    Other proteins in same PDB: d1n20a2, d1n20b2
    complexed with 3ag, mg

Details for d1n20b1

PDB Entry: 1n20 (more details), 2.3 Å

PDB Description: (+)-Bornyl Diphosphate Synthase: Complex with Mg and 3-aza-2,3-dihydrogeranyl diphosphate
PDB Compounds: (B:) (+)-bornyl diphosphate synthase

SCOPe Domain Sequences for d1n20b1:

Sequence, based on SEQRES records: (download)

>d1n20b1 a.102.4.1 (B:61-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]}
qpalwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsd
ffqdeikeilgviynehkcfhnnevekmdlyftalgfrllrqhgfnisqdvfncfknekg
idfkaslaqdtkgmlqlyeasfllrkgedtlelarefatkclqkkldeggneidenlllw
irhsldlplhwriqsvearwfidayarrpd

Sequence, based on observed residues (ATOM records): (download)

>d1n20b1 a.102.4.1 (B:61-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]}
qpalwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsd
ffqdeikeilgviynehkcfdlyftalgfrllrqhgfnisqdvfncfknekgidfkasla
qdtkgmlqlyeasfllrkgedtlelarefatkclqkkldneidenlllwirhsldlplhw
riqsvearwfidayarrpd

SCOPe Domain Coordinates for d1n20b1:

Click to download the PDB-style file with coordinates for d1n20b1.
(The format of our PDB-style files is described here.)

Timeline for d1n20b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n20b2