Lineage for d1n1ya1 (1n1y A:413-634)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 295172Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)
  6. 295173Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)
  7. 295190Species Trypanosoma rangeli [TaxId:5698] [82040] (6 PDB entries)
  8. 295195Domain d1n1ya1: 1n1y A:413-634 [79826]
    Other proteins in same PDB: d1n1ya2
    complexed with sia

Details for d1n1ya1

PDB Entry: 1n1y (more details), 2.8 Å

PDB Description: trypanosoma rangeli sialidase in complex with sialic acid

SCOP Domain Sequences for d1n1ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1ya1 b.29.1.15 (A:413-634) Trypanosoma sialidase, C-terminal domain {Trypanosoma rangeli}
gcgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvar
qgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrply
gaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyigg
prskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtd

SCOP Domain Coordinates for d1n1ya1:

Click to download the PDB-style file with coordinates for d1n1ya1.
(The format of our PDB-style files is described here.)

Timeline for d1n1ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n1ya2