Lineage for d1n1va2 (1n1v A:1-406)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553917Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1553918Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1553919Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1554146Protein Trypanosoma sialidase [82164] (2 species)
  7. 1554167Species Trypanosoma rangeli [TaxId:5698] [82165] (7 PDB entries)
    Uniprot O44049 20-653
  8. 1554170Domain d1n1va2: 1n1v A:1-406 [79825]
    Other proteins in same PDB: d1n1va1
    complexed with dan, so4

Details for d1n1va2

PDB Entry: 1n1v (more details), 2.1 Å

PDB Description: trypanosoma rangeli sialidase in complex with dana
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1n1va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1va2 b.68.1.1 (A:1-406) Trypanosoma sialidase {Trypanosoma rangeli [TaxId: 5698]}
aaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryet
sfdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnkt
rnswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefv
ggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlew
egkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtieg
krvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslh
eintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpa

SCOPe Domain Coordinates for d1n1va2:

Click to download the PDB-style file with coordinates for d1n1va2.
(The format of our PDB-style files is described here.)

Timeline for d1n1va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n1va1