Lineage for d1n1ta1 (1n1t A:413-634)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119532Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)
  6. 1119533Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)
  7. 1119554Species Trypanosoma rangeli [TaxId:5698] [82040] (10 PDB entries)
    Uniprot O44049 20-653
  8. 1119555Domain d1n1ta1: 1n1t A:413-634 [79821]
    Other proteins in same PDB: d1n1ta2
    complexed with dan, so4

Details for d1n1ta1

PDB Entry: 1n1t (more details), 1.6 Å

PDB Description: trypanosoma rangeli sialidase in complex with dana at 1.6 a
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1n1ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1ta1 b.29.1.15 (A:413-634) Trypanosoma sialidase, C-terminal domain {Trypanosoma rangeli [TaxId: 5698]}
gcgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvar
qgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrply
gaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyigg
prskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtd

SCOPe Domain Coordinates for d1n1ta1:

Click to download the PDB-style file with coordinates for d1n1ta1.
(The format of our PDB-style files is described here.)

Timeline for d1n1ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n1ta2