Lineage for d1n1sa2 (1n1s A:1-406)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 233193Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 233194Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 233195Family b.68.1.1: Sialidases (neuraminidases) [50940] (7 proteins)
  6. 233294Protein Trypanosoma rangeli sialidase [82164] (1 species)
  7. 233295Species Trypanosoma rangeli [TaxId:5698] [82165] (6 PDB entries)
  8. 233297Domain d1n1sa2: 1n1s A:1-406 [79820]
    Other proteins in same PDB: d1n1sa1
    complexed with so4

Details for d1n1sa2

PDB Entry: 1n1s (more details), 1.64 Å

PDB Description: Trypanosoma rangeli sialidase

SCOP Domain Sequences for d1n1sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1sa2 b.68.1.1 (A:1-406) Trypanosoma rangeli sialidase {Trypanosoma rangeli}
aaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryet
sfdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnkt
rnswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefv
ggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlew
egkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtieg
krvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslh
eintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpa

SCOP Domain Coordinates for d1n1sa2:

Click to download the PDB-style file with coordinates for d1n1sa2.
(The format of our PDB-style files is described here.)

Timeline for d1n1sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n1sa1