Lineage for d1n1fa_ (1n1f A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318696Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2318697Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2319033Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2319116Protein Interleukin-19 [81744] (1 species)
  7. 2319117Species Human (Homo sapiens) [TaxId:9606] [81745] (1 PDB entry)
  8. 2319118Domain d1n1fa_: 1n1f A: [79803]
    complexed with nag

Details for d1n1fa_

PDB Entry: 1n1f (more details), 1.95 Å

PDB Description: crystal structure of human interleukin-19
PDB Compounds: (A:) interleukin-19

SCOPe Domain Sequences for d1n1fa_:

Sequence, based on SEQRES records: (download)

>d1n1fa_ a.26.1.3 (A:) Interleukin-19 {Human (Homo sapiens) [TaxId: 9606]}
nhglrrclistdmhhieesfqeikraiqakdtfpnvtilstletlqiikpldvccvtknl
lafyvdrvfkdhqepnpkilrkissiansflymqktlrqcqeqrqchcrqeatnatrvih
dnydqlevhaaaikslgeldvflawinknhevmssa

Sequence, based on observed residues (ATOM records): (download)

>d1n1fa_ a.26.1.3 (A:) Interleukin-19 {Human (Homo sapiens) [TaxId: 9606]}
nhglrrclistdmhhieesfqeikraiqakdtfpnvtilstletlqiikpldvccvtknl
lafyvdrvfkdhqepnpkilrkissiansflymqktlrqcqqchcrqeatnatrvihdny
dqlevhaaaikslgeldvflawinknhevmssa

SCOPe Domain Coordinates for d1n1fa_:

Click to download the PDB-style file with coordinates for d1n1fa_.
(The format of our PDB-style files is described here.)

Timeline for d1n1fa_: