![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
![]() | Protein Interleukin-19 [81744] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81745] (1 PDB entry) |
![]() | Domain d1n1fa_: 1n1f A: [79803] complexed with nag |
PDB Entry: 1n1f (more details), 1.95 Å
SCOPe Domain Sequences for d1n1fa_:
Sequence, based on SEQRES records: (download)
>d1n1fa_ a.26.1.3 (A:) Interleukin-19 {Human (Homo sapiens) [TaxId: 9606]} nhglrrclistdmhhieesfqeikraiqakdtfpnvtilstletlqiikpldvccvtknl lafyvdrvfkdhqepnpkilrkissiansflymqktlrqcqeqrqchcrqeatnatrvih dnydqlevhaaaikslgeldvflawinknhevmssa
>d1n1fa_ a.26.1.3 (A:) Interleukin-19 {Human (Homo sapiens) [TaxId: 9606]} nhglrrclistdmhhieesfqeikraiqakdtfpnvtilstletlqiikpldvccvtknl lafyvdrvfkdhqepnpkilrkissiansflymqktlrqcqqchcrqeatnatrvihdny dqlevhaaaikslgeldvflawinknhevmssa
Timeline for d1n1fa_: