Lineage for d1n1ab_ (1n1a B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501849Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 501850Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 501851Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 501933Protein FKBP52, N-terminal domain [82619] (1 species)
  7. 501934Species Human (Homo sapiens) [TaxId:9606] [82620] (4 PDB entries)
  8. 501938Domain d1n1ab_: 1n1a B: [79798]

Details for d1n1ab_

PDB Entry: 1n1a (more details), 2.4 Å

PDB Description: crystal structure of the n-terminal domain of human fkbp52

SCOP Domain Sequences for d1n1ab_:

Sequence, based on SEQRES records: (download)

>d1n1ab_ d.26.1.1 (B:) FKBP52, N-terminal domain {Human (Homo sapiens)}
aplpmegvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkd
kfsfdlgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelf
efkge

Sequence, based on observed residues (ATOM records): (download)

>d1n1ab_ d.26.1.1 (B:) FKBP52, N-terminal domain {Human (Homo sapiens)}
aplpmegvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdsslkfsf
dlgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefkg
e

SCOP Domain Coordinates for d1n1ab_:

Click to download the PDB-style file with coordinates for d1n1ab_.
(The format of our PDB-style files is described here.)

Timeline for d1n1ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1n1aa_