Lineage for d1n1aa_ (1n1a A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548501Protein FKBP52, N-terminal domains [82619] (1 species)
  7. 2548502Species Human (Homo sapiens) [TaxId:9606] [82620] (10 PDB entries)
    Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains
  8. 2548514Domain d1n1aa_: 1n1a A: [79797]

Details for d1n1aa_

PDB Entry: 1n1a (more details), 2.4 Å

PDB Description: crystal structure of the n-terminal domain of human fkbp52
PDB Compounds: (A:) fkbp52

SCOPe Domain Sequences for d1n1aa_:

Sequence, based on SEQRES records: (download)

>d1n1aa_ d.26.1.1 (A:) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
aplpmegvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkd
kfsfdlgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelf
efkge

Sequence, based on observed residues (ATOM records): (download)

>d1n1aa_ d.26.1.1 (A:) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
aplpmegvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdsslkfsf
dlgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefkg
e

SCOPe Domain Coordinates for d1n1aa_:

Click to download the PDB-style file with coordinates for d1n1aa_.
(The format of our PDB-style files is described here.)

Timeline for d1n1aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1n1ab_