Lineage for d1n1aa_ (1n1a A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255712Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 255713Superfamily d.26.1: FKBP-like [54534] (2 families) (S)
  5. 255714Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (11 proteins)
  6. 255781Protein FKBP52, N-terminal domain [82619] (1 species)
  7. 255782Species Human (Homo sapiens) [TaxId:9606] [82620] (1 PDB entry)
  8. 255783Domain d1n1aa_: 1n1a A: [79797]

Details for d1n1aa_

PDB Entry: 1n1a (more details), 2.4 Å

PDB Description: Crystal Structure of the N-terminal domain of human FKBP52

SCOP Domain Sequences for d1n1aa_:

Sequence, based on SEQRES records: (download)

>d1n1aa_ d.26.1.1 (A:) FKBP52, N-terminal domain {Human (Homo sapiens)}
aplpmegvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkd
kfsfdlgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelf
efkge

Sequence, based on observed residues (ATOM records): (download)

>d1n1aa_ d.26.1.1 (A:) FKBP52, N-terminal domain {Human (Homo sapiens)}
aplpmegvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdsslkfsf
dlgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefkg
e

SCOP Domain Coordinates for d1n1aa_:

Click to download the PDB-style file with coordinates for d1n1aa_.
(The format of our PDB-style files is described here.)

Timeline for d1n1aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1n1ab_