Lineage for d1n1aa_ (1n1a A:)
- Root: SCOP 1.63
Class d: Alpha and beta proteins (a+b) [53931] (224 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheet
Superfamily d.26.1: FKBP-like [54534] (2 families) 
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (11 proteins) 
Protein FKBP52, N-terminal domain [82619] (1 species) Species Human (Homo sapiens) [TaxId:9606] [82620] (1 PDB entry) 
Domain d1n1aa_: 1n1a A: [79797]
Details for d1n1aa_
PDB Entry: 1n1a (more details), 2.4 Å
PDB Description: Crystal Structure of the N-terminal domain of human FKBP52
SCOP Domain Sequences for d1n1aa_:
Sequence, based on SEQRES records: (download)
>d1n1aa_ d.26.1.1 (A:) FKBP52, N-terminal domain {Human (Homo sapiens)}
aplpmegvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkd
kfsfdlgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelf
efkge
Sequence, based on observed residues (ATOM records): (download)
>d1n1aa_ d.26.1.1 (A:) FKBP52, N-terminal domain {Human (Homo sapiens)}
aplpmegvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdsslkfsf
dlgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefkg
e
SCOP Domain Coordinates for d1n1aa_:
Click to download the PDB-style file with coordinates for d1n1aa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n1aa_:
- d1n1aa_ is new in SCOP 1.63
- d1n1aa_ appears in SCOP 1.65
- d1n1aa_ appears in the current release, SCOPe 2.08
View in 3D
