Lineage for d1n18f_ (1n18 F:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658038Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 658039Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 658052Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)
  7. 658133Species Human (Homo sapiens) [TaxId:9606] [49333] (27 PDB entries)
  8. 658252Domain d1n18f_: 1n18 F: [79790]

Details for d1n18f_

PDB Entry: 1n18 (more details), 2 Å

PDB Description: thermostable mutant of human superoxide dismutase, c6a, c111s
PDB Compounds: (F:) Superoxide dismutase [Cu-Zn]

SCOP Domain Sequences for d1n18f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n18f_ b.1.8.1 (F:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOP Domain Coordinates for d1n18f_:

Click to download the PDB-style file with coordinates for d1n18f_.
(The format of our PDB-style files is described here.)

Timeline for d1n18f_: