Lineage for d1n16b1 (1n16 B:8-102)
- Root: SCOP 1.71
Class a: All alpha proteins [46456] (226 folds) 
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
irregular array of 6 short helicesSuperfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family) 
Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) 
Protein Creatine kinase, N-domain [48036] (7 species) 
Species Pacific electric ray (Torpedo californica) [TaxId:7787] [81820] (1 PDB entry) 
Domain d1n16b1: 1n16 B:8-102 [79783]
Other proteins in same PDB: d1n16a2, d1n16b2
complexed with adp, iom, mg, no3
Details for d1n16b1
PDB Entry: 1n16 (more details), 2.1 Å
PDB Description: The 2.1 Structure of T. californica Creatine Kinase Complexed with the Transition-State Analogue Complex, ADP-Mg 2+ /NO3-/Creatine
SCOP Domain Sequences for d1n16b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n16b1 a.83.1.1 (B:8-102) Creatine kinase, N-domain {Pacific electric ray (Torpedo californica)}
nkwklnysaaeefpdlskhnnhmakaltldiykklrdketpsgftlddiiqtgvdnpghp
fimtvgcvagdeecyevfkdlfdpviedrhggykp
SCOP Domain Coordinates for d1n16b1:
Click to download the PDB-style file with coordinates for d1n16b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n16b1:
- d1n16b1 first appeared in SCOP 1.63
- d1n16b1 appears in SCOP 1.69
- d1n16b1 does not appear in SCOP 1.73
View in 3D
