Lineage for d1n16a2 (1n16 A:103-381)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
duplication: common core consists of two beta-alpha-beta2-alpha repeatsSuperfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (4 families) 
Family d.128.1.2: Guanido kinase catalytic domain [55935] (2 proteins) 
Protein Creatine kinase, C-terminal domain [55936] (7 species) 
Species Pacific electric ray (Torpedo californica) [TaxId:7787] [82781] (1 PDB entry) 
Domain d1n16a2: 1n16 A:103-381 [79782]
Other proteins in same PDB: d1n16a1, d1n16b1
Details for d1n16a2
PDB Entry: 1n16 (more details), 2.1 Å
PDB Description: The 2.1 Structure of T. californica Creatine Kinase Complexed with the Transition-State Analogue Complex, ADP-Mg 2+ /NO3-/Creatine
SCOP Domain Sequences for d1n16a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n16a2 d.128.1.2 (A:103-381) Creatine kinase, C-terminal domain {Pacific electric ray (Torpedo californica)}
tdkhktdlnqenlkggddldpnyvlssrvrtgrsikgialpphcsrgerrlveklcidgl
atltgefqgkyyplssmsdaeqqqliddhflfdkpisplllasgmardwpdgrgiwhnnd
ktflvwvneedhlrvismqkggnmkevfrrfcvglkkiedifvkagrgfmwnehlgyvlt
cpsnlgtglrggvhvkiphlckhekfsevlkrtrlqkrgtggvdtaavgsiydisnadrl
gfseveqvqmvvdgvklmvemekrlengksiddlmpaqk
SCOP Domain Coordinates for d1n16a2:
Click to download the PDB-style file with coordinates for d1n16a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n16a2:
- d1n16a2 first appeared in SCOP 1.63
- d1n16a2 appears in SCOP 1.69
- d1n16a2 does not appear in SCOP 1.73
View in 3D
