SCOPe 2.08: Domain d1n10b1: 1n10 B:2146-2240

Lineage for d1n10b1 (1n10 B:2146-2240)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.3: PHL pollen allergen [49590] (2 families)

5. Family b.7.3.1: PHL pollen allergen [49591] (3 proteins)
   automatically mapped to Pfam PF01357

6. Protein PHL P 1 C-terminal domain [82001] (1 species)

7. Species Timothy grass (Phleum pratense) [TaxId:15957] [82002] (1 PDB entry)

8. Domain d1n10b1: 1n10 B:2146-2240 [79776]
   Other proteins in same PDB: d1n10a2, d1n10b2
   complexed with nag

Details for d1n10b1

PDB Entry: 1n10, 2.9 Å

PDB Description: crystal structure of phl p 1, a major timothy grass pollen allergen

PDB Compounds: (B:) Pollen allergen Phl p 1

SCOPe Domain Sequences for d1n10b1:

Sequence; same for both SEQRES and ATOM records:

>d1n10b1 b.7.3.1 (B:2146-2240) PHL P 1 C-terminal domain {Timothy grass (Phleum pratense) [TaxId: 15957]}
tkvtfhvekgsnpnylallvkyvngdgdvvavdikekgkdkwielkeswgaiwridtpdk
ltgpftvrytteggtkteaedvipegwkadtsyes

Timeline for d1n10b1:

• d1n10b1 first appeared in SCOP 1.63
  
• d1n10b1 appears in SCOPe 2.07