Lineage for d1n0wb_ (1n0w B:)

  1. Root: SCOPe 2.06
  2. 2271421Class j: Peptides [58231] (133 folds)
  3. 2273070Fold j.97: BRCA2 BRC4 repeat [82985] (1 superfamily)
  4. 2273071Superfamily j.97.1: BRCA2 BRC4 repeat [82986] (1 family) (S)
  5. 2273072Family j.97.1.1: BRCA2 BRC4 repeat [82987] (1 protein)
  6. 2273073Protein BRCA2 BRC4 repeat [82988] (1 species)
  7. 2273074Species Human (Homo sapiens) [TaxId:9606] [82989] (1 PDB entry)
  8. 2273075Domain d1n0wb_: 1n0w B: [79773]
    Other proteins in same PDB: d1n0wa_
    bound to Rad51
    protein/DNA complex; complexed with cl, edo, mg

Details for d1n0wb_

PDB Entry: 1n0w (more details), 1.7 Å

PDB Description: crystal structure of a rad51-brca2 brc repeat complex
PDB Compounds: (B:) Breast Cancer type 2 susceptibility protein

SCOPe Domain Sequences for d1n0wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0wb_ j.97.1.1 (B:) BRCA2 BRC4 repeat {Human (Homo sapiens) [TaxId: 9606]}
ptllgfhtasgkkvkiakesldkvknlfdekeq

SCOPe Domain Coordinates for d1n0wb_:

Click to download the PDB-style file with coordinates for d1n0wb_.
(The format of our PDB-style files is described here.)

Timeline for d1n0wb_:

2273075
d1n0wb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1n0wa_