Lineage for d1n0vc2 (1n0v C:2-343)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110387Protein Elongation factor 2 (eEF-2), N-terminal (G) domain [82404] (2 species)
  7. 2110388Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82405] (13 PDB entries)
    Uniprot P32324
  8. 2110400Domain d1n0vc2: 1n0v C:2-343 [79763]
    Other proteins in same PDB: d1n0vc1, d1n0vc3, d1n0vc4, d1n0vc5, d1n0vd1, d1n0vd3, d1n0vd4, d1n0vd5

Details for d1n0vc2

PDB Entry: 1n0v (more details), 2.85 Å

PDB Description: Crystal structure of elongation factor 2
PDB Compounds: (C:) Elongation factor 2

SCOPe Domain Sequences for d1n0vc2:

Sequence, based on SEQRES records: (download)

>d1n0vc2 c.37.1.8 (C:2-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrk
deqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrv
tdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfart
vesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmm
drlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvlle
kleivlkgdekdlegkallkvvmrkflpaadallemivlhlp

Sequence, based on observed residues (ATOM records): (download)

>d1n0vc2 c.37.1.8 (C:2-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakgitikstaisl
ysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcv
qtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevl
gdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkw
tnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegk
allkvvmrkflpaadallemivlhlp

SCOPe Domain Coordinates for d1n0vc2:

Click to download the PDB-style file with coordinates for d1n0vc2.
(The format of our PDB-style files is described here.)

Timeline for d1n0vc2: