SCOPe 2.07: Domain d1n0nb2: 1n0n B:84-198

Lineage for d1n0nb2 (1n0n B:84-198)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries)

8. Domain d1n0nb2: 1n0n B:84-198 [79753]
   Other proteins in same PDB: d1n0na1, d1n0nb1
   complexed with mn, so4

Details for d1n0nb2

PDB Entry: 1n0n, 1.82 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his30 in human manganese superoxide dismutase

PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d1n0nb2:

Sequence; same for both SEQRES and ATOM records:

>d1n0nb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d1n0nb2:

• d1n0nb2 first appeared in SCOP 1.63
  
• d1n0nb2 appears in SCOPe 2.06
  
• d1n0nb2 appears in the current release, SCOPe 2.08