Lineage for d1n0nb1 (1n0n B:1-83)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633495Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 633496Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 633622Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)
  7. 633675Species Human (Homo sapiens) [TaxId:9606] [46619] (23 PDB entries)
  8. 633697Domain d1n0nb1: 1n0n B:1-83 [79752]
    Other proteins in same PDB: d1n0na2, d1n0nb2
    complexed with mn, so4; mutant

Details for d1n0nb1

PDB Entry: 1n0n (more details), 1.82 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his30 in human manganese superoxide dismutase
PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOP Domain Sequences for d1n0nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0nb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskvhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d1n0nb1:

Click to download the PDB-style file with coordinates for d1n0nb1.
(The format of our PDB-style files is described here.)

Timeline for d1n0nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n0nb2