Lineage for d1n0lc2 (1n0l C:125-215)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792147Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 792269Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 792270Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 792311Protein PapD [49586] (1 species)
  7. 792312Species Escherichia coli [TaxId:562] [49587] (9 PDB entries)
  8. 792317Domain d1n0lc2: 1n0l C:125-215 [79748]
    Other proteins in same PDB: d1n0la1, d1n0lb_, d1n0lc1, d1n0ld_
    complexed with mse; mutant

Details for d1n0lc2

PDB Entry: 1n0l (more details), 2.3 Å

PDB Description: Crystal structure of the PapD chaperone (C-terminally 6x histidine-tagged) bound to the PapE pilus subunit (N-terminal-deleted) from uropathogenic E. coli
PDB Compounds: (C:) chaperone protein papd

SCOP Domain Sequences for d1n0lc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0lc2 b.7.2.1 (C:125-215) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvk

SCOP Domain Coordinates for d1n0lc2:

Click to download the PDB-style file with coordinates for d1n0lc2.
(The format of our PDB-style files is described here.)

Timeline for d1n0lc2: