Lineage for d1n0lc2 (1n0l C:125-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773151Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2773152Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2773205Protein PapD [49586] (1 species)
  7. 2773206Species Escherichia coli [TaxId:562] [49587] (15 PDB entries)
  8. 2773213Domain d1n0lc2: 1n0l C:125-215 [79748]
    Other proteins in same PDB: d1n0la1, d1n0lb_, d1n0lc1, d1n0ld_

Details for d1n0lc2

PDB Entry: 1n0l (more details), 2.3 Å

PDB Description: Crystal structure of the PapD chaperone (C-terminally 6x histidine-tagged) bound to the PapE pilus subunit (N-terminal-deleted) from uropathogenic E. coli
PDB Compounds: (C:) chaperone protein papd

SCOPe Domain Sequences for d1n0lc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0lc2 b.7.2.1 (C:125-215) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvk

SCOPe Domain Coordinates for d1n0lc2:

Click to download the PDB-style file with coordinates for d1n0lc2.
(The format of our PDB-style files is described here.)

Timeline for d1n0lc2: