Lineage for d1n0lb_ (1n0l B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767643Protein PapE pilus subunit [81990] (1 species)
  7. 2767644Species Escherichia coli [TaxId:562] [81991] (2 PDB entries)
  8. 2767647Domain d1n0lb_: 1n0l B: [79746]
    Other proteins in same PDB: d1n0la1, d1n0la2, d1n0lc1, d1n0lc2
    N-terminal-deleted

Details for d1n0lb_

PDB Entry: 1n0l (more details), 2.3 Å

PDB Description: Crystal structure of the PapD chaperone (C-terminally 6x histidine-tagged) bound to the PapE pilus subunit (N-terminal-deleted) from uropathogenic E. coli
PDB Compounds: (B:) mature Fimbrial protein PapE

SCOPe Domain Sequences for d1n0lb_:

Sequence, based on SEQRES records: (download)

>d1n0lb_ b.2.3.2 (B:) PapE pilus subunit {Escherichia coli [TaxId: 562]}
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
nliagpfsatatlvasys

Sequence, based on observed residues (ATOM records): (download)

>d1n0lb_ b.2.3.2 (B:) PapE pilus subunit {Escherichia coli [TaxId: 562]}
vpactvsnttvdwqdvengnhekeftvnmrcpynlgtmkvtitatntynnailvqssdgl
lvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykpfsatatlvasys

SCOPe Domain Coordinates for d1n0lb_:

Click to download the PDB-style file with coordinates for d1n0lb_.
(The format of our PDB-style files is described here.)

Timeline for d1n0lb_: