SCOP 1.65: Domain d1n0hb1: 1n0h B:278-460

Lineage for d1n0hb1 (1n0h B:278-460)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (5 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Acetohydroxyacid synthase catalytic subunit [69463] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69464] (2 PDB entries)

8. Domain d1n0hb1: 1n0h B:278-460 [79737]
   Other proteins in same PDB: d1n0ha2, d1n0ha3, d1n0hb2, d1n0hb3
   complexed with ayd, cie, dtt, fad, k, mg, tpp

Details for d1n0hb1

PDB Entry: 1n0h, 2.8 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl

SCOP Domain Sequences for d1n0hb1:

Sequence; same for both SEQRES and ATOM records:

>d1n0hb1 c.31.1.3 (B:278-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
sraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlqg
lgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraaa
egrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkke
ypy

Timeline for d1n0hb1:

• d1n0hb1 first appeared in SCOP 1.63
  
• d1n0hb1 appears in SCOP 1.67
  
• d1n0hb1 appears in the current release, SCOPe 2.08