Lineage for d1n0hb1 (1n0h B:278-460)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242562Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 242563Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 242581Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (4 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 242582Protein Acetohydroxyacid synthase catalytic subunit [69463] (1 species)
  7. 242583Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69464] (2 PDB entries)
  8. 242587Domain d1n0hb1: 1n0h B:278-460 [79737]
    Other proteins in same PDB: d1n0ha2, d1n0ha3, d1n0hb2, d1n0hb3
    complexed with ayd, cie, dtt, fad, k, mg, tpp

Details for d1n0hb1

PDB Entry: 1n0h (more details), 2.8 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl

SCOP Domain Sequences for d1n0hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0hb1 c.31.1.3 (B:278-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
sraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlqg
lgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraaa
egrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkke
ypy

SCOP Domain Coordinates for d1n0hb1:

Click to download the PDB-style file with coordinates for d1n0hb1.
(The format of our PDB-style files is described here.)

Timeline for d1n0hb1: