![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
![]() | Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69464] (8 PDB entries) Uniprot P07342 84-687 |
![]() | Domain d1n0hb1: 1n0h B:278-460 [79737] Other proteins in same PDB: d1n0ha2, d1n0ha3, d1n0hb2, d1n0hb3 complexed with ayd, cie, dtt, fad, k, mg, tpp |
PDB Entry: 1n0h (more details), 2.8 Å
SCOPe Domain Sequences for d1n0hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0hb1 c.31.1.3 (B:278-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlqg lgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraaa egrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkke ypy
Timeline for d1n0hb1: