Lineage for d1n0ha2 (1n0h A:83-270)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2864566Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 2864567Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species)
  7. 2864568Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88734] (8 PDB entries)
    Uniprot P07342 84-687
  8. 2864585Domain d1n0ha2: 1n0h A:83-270 [79735]
    Other proteins in same PDB: d1n0ha1, d1n0ha3, d1n0hb1, d1n0hb3
    complexed with ayd, cie, dtt, fad, k, mg, tpp

Details for d1n0ha2

PDB Entry: 1n0h (more details), 2.8 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl
PDB Compounds: (A:) Acetolactate synthase

SCOPe Domain Sequences for d1n0ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0ha2 c.36.1.5 (A:83-270) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
ptkttlps

SCOPe Domain Coordinates for d1n0ha2:

Click to download the PDB-style file with coordinates for d1n0ha2.
(The format of our PDB-style files is described here.)

Timeline for d1n0ha2: