Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) |
Family b.43.5.1: ATP-dependent riboflavin kinase-like [82115] (2 proteins) automatically mapped to Pfam PF01687 |
Protein Riboflavin kinase [82116] (2 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82117] (4 PDB entries) |
Domain d1n06a_: 1n06 A: [79726] complexed with adp |
PDB Entry: 1n06 (more details), 2 Å
SCOPe Domain Sequences for d1n06a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n06a_ b.43.5.1 (A:) Riboflavin kinase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} rpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfgy amvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnyag ldkliedihtdirvalnsmdrpsyssykkdpffk
Timeline for d1n06a_: