SCOPe 2.01: Domain d1mzuc_: 1mzu C:

Lineage for d1mzuc_ (1mzu C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein PYP domain of sensor histidine kinase Ppr [82762] (1 species)

7. Species Rhodospirillum centenum [TaxId:34018] [82763] (1 PDB entry)

8. Domain d1mzuc_: 1mzu C: [79716]
   complexed with hc4

Details for d1mzuc_

PDB Entry: 1mzu, 2 Å

PDB Description: Crystal Structure of the Photoactive Yellow Protein Domain from the Sensor Histidine Kinase Ppr from Rhodospirillum centenum

PDB Compounds: (C:) ppr

SCOPe Domain Sequences for d1mzuc_:

Sequence, based on SEQRES records:

>d1mzuc_ d.110.3.1 (C:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]}
irgtidgmgtaefdalpvgaiqvdgsgvihrynrtesrlsgripervigrnfftevapct
nipafsgrfmdgvtsgtldarfdfvfdfqmapvrvqirmqnagvpdrywifvrk

Sequence, based on observed residues (ATOM records):

>d1mzuc_ d.110.3.1 (C:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]}
irgtidgmgtaefdalpvgaiqvdgsgvihrynrtesrlsgripervigrnfftevapct
nipafsgrfmdgvtsgtldarfdfvpvrvqirmqnagvpdrywifvrk

Timeline for d1mzuc_:

• d1mzuc_ first appeared in SCOP 1.63
  
• d1mzuc_ appears in SCOP 1.75
  
• d1mzuc_ appears in SCOPe 2.02
  
• d1mzuc_ appears in the current release, SCOPe 2.08