![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.1: PYP-like [55786] (2 proteins) |
![]() | Protein PYP domain of sensor histidine kinase Ppr [82762] (1 species) |
![]() | Species Rhodospirillum centenum [TaxId:34018] [82763] (1 PDB entry) |
![]() | Domain d1mzub_: 1mzu B: [79715] complexed with hc4 |
PDB Entry: 1mzu (more details), 2 Å
SCOPe Domain Sequences for d1mzub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mzub_ d.110.3.1 (B:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} irgtidgmgtaefdalpvgaiqvdgsgvihrynrtesrlsgripervigrnfftevapct nipafsgrfmdgvtsgtldarfdfvfdfqmapvrvqirmqnagvpdrywifvrk
Timeline for d1mzub_: