Lineage for d1mzub_ (1mzu B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037952Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1038114Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1038115Family d.110.3.1: PYP-like [55786] (2 proteins)
  6. 1038167Protein PYP domain of sensor histidine kinase Ppr [82762] (1 species)
  7. 1038168Species Rhodospirillum centenum [TaxId:34018] [82763] (1 PDB entry)
  8. 1038170Domain d1mzub_: 1mzu B: [79715]
    complexed with hc4

Details for d1mzub_

PDB Entry: 1mzu (more details), 2 Å

PDB Description: Crystal Structure of the Photoactive Yellow Protein Domain from the Sensor Histidine Kinase Ppr from Rhodospirillum centenum
PDB Compounds: (B:) ppr

SCOPe Domain Sequences for d1mzub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzub_ d.110.3.1 (B:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]}
irgtidgmgtaefdalpvgaiqvdgsgvihrynrtesrlsgripervigrnfftevapct
nipafsgrfmdgvtsgtldarfdfvfdfqmapvrvqirmqnagvpdrywifvrk

SCOPe Domain Coordinates for d1mzub_:

Click to download the PDB-style file with coordinates for d1mzub_.
(The format of our PDB-style files is described here.)

Timeline for d1mzub_: