SCOP 1.75: Domain d1mzua_: 1mzu A:

Lineage for d1mzua_ (1mzu A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (7 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein PYP domain of sensor histidine kinase Ppr [82762] (1 species)

7. Species Rhodospirillum centenum [TaxId:34018] [82763] (1 PDB entry)

8. Domain d1mzua_: 1mzu A: [79714]

Details for d1mzua_

PDB Entry: 1mzu, 2 Å

PDB Description: Crystal Structure of the Photoactive Yellow Protein Domain from the Sensor Histidine Kinase Ppr from Rhodospirillum centenum

PDB Compounds: (A:) ppr

SCOP Domain Sequences for d1mzua_:

Sequence, based on SEQRES records:

>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]}
idgmgtaefdalpvgaiqvdgsgvihrynrtesrlsgripervigrnfftevapctnipa
fsgrfmdgvtsgtldarfdfvfdfqmapvrvqirmqnagvpdrywifvrk

Sequence, based on observed residues (ATOM records):

>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]}
idtaefdalpvgaiqvdgsgvihrynrtesrlsgripervigrnfftevapctnipafsg
rfmdgvtsgtldarfdfvfdfqmapvrvqirmqnagvpdrywifvrk

Timeline for d1mzua_:

• d1mzua_ first appeared in SCOP 1.63
  
• d1mzua_ appears in SCOP 1.73
  
• d1mzua_ appears in SCOPe 2.01
  
• d1mzua_ appears in the current release, SCOPe 2.08