Lineage for d1mzta_ (1mzt A:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266033Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) (S)
  5. 2266034Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)
  6. 2266035Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)
  7. 2266036Species Bacteriophage fd [TaxId:10864] [57990] (7 PDB entries)
  8. 2266043Domain d1mzta_: 1mzt A: [79713]

Details for d1mzta_

PDB Entry: 1mzt (more details)

PDB Description: nmr structure of the fd bacteriophage pviii coat protein in lipid bilayer membranes
PDB Compounds: (A:) major coat protein pVIII

SCOPe Domain Sequences for d1mzta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzta_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage fd [TaxId: 10864]}
akaafdslqasateyigyawamvvvivgatigiklfkkf

SCOPe Domain Coordinates for d1mzta_:

Click to download the PDB-style file with coordinates for d1mzta_.
(The format of our PDB-style files is described here.)

Timeline for d1mzta_: