Lineage for d1mzsa2 (1mzs A:175-317)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 251049Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudodyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest
  4. 251050Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 251051Family c.95.1.1: Thiolase-related [53902] (6 proteins)
  6. 251193Protein Ketoacyl-ACP synthase III (FabH) [53912] (2 species)
  7. 251194Species Escherichia coli [TaxId:562] [53913] (7 PDB entries)
  8. 251212Domain d1mzsa2: 1mzs A:175-317 [79712]
    complexed with 669, ocs, po4

Details for d1mzsa2

PDB Entry: 1mzs (more details), 2.1 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii with bound dichlorobenzyloxy-indole-carboxylic acid inhibitor

SCOP Domain Sequences for d1mzsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzsa2 c.95.1.1 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli}
isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld
rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik
pgqlvlleafgggftwgsalvrf

SCOP Domain Coordinates for d1mzsa2:

Click to download the PDB-style file with coordinates for d1mzsa2.
(The format of our PDB-style files is described here.)

Timeline for d1mzsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mzsa1