Lineage for d1mzng_ (1mzn G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729438Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2729439Species Human (Homo sapiens) [TaxId:9606] [48511] (38 PDB entries)
    Uniprot P19793 227-458
  8. 2729444Domain d1mzng_: 1mzn G: [79707]
    complexed with co-activator peptide
    complexed with bm6

Details for d1mzng_

PDB Entry: 1mzn (more details), 1.9 Å

PDB Description: crystal structure at 1.9 angstroems resolution of the homodimer of human rxr alpha ligand binding domain bound to the synthetic agonist compound bms 649 and a coactivator peptide
PDB Compounds: (G:) RXR retinoid X receptor

SCOPe Domain Sequences for d1mzng_:

Sequence, based on SEQRES records: (download)

>d1mzng_ a.123.1.1 (G:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
dmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriph
fselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdr
vltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhky
peqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Sequence, based on observed residues (ATOM records): (download)

>d1mzng_ a.123.1.1 (G:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
dmpverileaelavepdpvtnicqaadkqlftlvewakriphfselplddqvillragwn
elliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdkte
lgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalr
siglkclehlfffkligdtpidtflmemleap

SCOPe Domain Coordinates for d1mzng_:

Click to download the PDB-style file with coordinates for d1mzng_.
(The format of our PDB-style files is described here.)

Timeline for d1mzng_: