SCOPe 2.07: Domain d1mzjb1: 1mzj B:2-183

Lineage for d1mzjb1 (1mzj B:2-183)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway [82561] (1 species)

7. Species Streptomyces sp. r1128 [TaxId:140437] [82562] (1 PDB entry)

8. Domain d1mzjb1: 1mzj B:2-183 [79702]
   complexed with ace, coa

Details for d1mzjb1

PDB Entry: 1mzj, 2.1 Å

PDB Description: Crystal Structure of the Priming beta-Ketosynthase from the R1128 Polyketide Biosynthetic Pathway

PDB Compounds: (B:) Beta-ketoacylsynthase III

SCOPe Domain Sequences for d1mzjb1:

Sequence; same for both SEQRES and ATOM records:

>d1mzjb1 c.95.1.2 (B:2-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]}
pglrvperrfsrvlgvgsyrprrevsnkevctwidsteewietrtgirsrriaepdetiq
vmgvaasrralehagvdpaeidlvvvstmtnfvhtpplsvaiahelgadnaggfdlsaac
agfchalsiaadavesggsrhvlvvatermtdvidladrslsflfgdgagaavvgpsdvp
gi

Timeline for d1mzjb1:

• d1mzjb1 first appeared in SCOP 1.63
  
• d1mzjb1 appears in SCOPe 2.06
  
• d1mzjb1 appears in the current release, SCOPe 2.08