![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
![]() | Protein Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway [82561] (1 species) |
![]() | Species Streptomyces sp. r1128 [TaxId:140437] [82562] (1 PDB entry) |
![]() | Domain d1mzja2: 1mzj A:184-336 [79701] complexed with ace, coa |
PDB Entry: 1mzj (more details), 2.1 Å
SCOPe Domain Sequences for d1mzja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} gpvvrgidgtglgslhmssswdqyvedpsvgrpalvmdgkrvfrwavadvvpaarealev agltvgdlvafvphqanlriidvlvdrlgvpehvvvsrdaedtgntssasvalaldrlvr sgavpgggpalmigfgaglsyagqalllpdpps
Timeline for d1mzja2: