Lineage for d1mzja2 (1mzj A:184-336)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2164936Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 2165187Protein Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway [82561] (1 species)
  7. 2165188Species Streptomyces sp. r1128 [TaxId:140437] [82562] (1 PDB entry)
  8. 2165190Domain d1mzja2: 1mzj A:184-336 [79701]
    complexed with ace, coa

Details for d1mzja2

PDB Entry: 1mzj (more details), 2.1 Å

PDB Description: Crystal Structure of the Priming beta-Ketosynthase from the R1128 Polyketide Biosynthetic Pathway
PDB Compounds: (A:) Beta-ketoacylsynthase III

SCOPe Domain Sequences for d1mzja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]}
gpvvrgidgtglgslhmssswdqyvedpsvgrpalvmdgkrvfrwavadvvpaarealev
agltvgdlvafvphqanlriidvlvdrlgvpehvvvsrdaedtgntssasvalaldrlvr
sgavpgggpalmigfgaglsyagqalllpdpps

SCOPe Domain Coordinates for d1mzja2:

Click to download the PDB-style file with coordinates for d1mzja2.
(The format of our PDB-style files is described here.)

Timeline for d1mzja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mzja1