Lineage for d1mzea_ (1mze A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2070961Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein)
  6. 2070962Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)
  7. 2070963Species Human (Homo sapiens) [TaxId:9606] [82196] (34 PDB entries)
  8. 2070968Domain d1mzea_: 1mze A: [79694]
    complexed with fe2, tar

Details for d1mzea_

PDB Entry: 1mze (more details), 2.2 Å

PDB Description: Human Factor Inhibiting HIF (FIH1)
PDB Compounds: (A:) factor inhibiting hif1

SCOPe Domain Sequences for d1mzea_:

Sequence, based on SEQRES records: (download)

>d1mzea_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
sgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvyp
alkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefvekl
qdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligme
gnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerf
pnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplka
hqkvaimrniekmlgealgnpqevgpllntmikgryn

Sequence, based on observed residues (ATOM records): (download)

>d1mzea_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
sgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvyp
alkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefvekl
qdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligme
gnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerf
pnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpieyplkahq
kvaimrniekmlgealgnpqevgpllntmikgryn

SCOPe Domain Coordinates for d1mzea_:

Click to download the PDB-style file with coordinates for d1mzea_.
(The format of our PDB-style files is described here.)

Timeline for d1mzea_: