![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.7: Assembly domain of cartilage oligomeric matrix protein [58006] (1 family) ![]() |
![]() | Family h.1.7.1: Assembly domain of cartilage oligomeric matrix protein [58007] (1 protein) |
![]() | Protein Assembly domain of cartilage oligomeric matrix protein [58008] (1 species) pentameric coiled-coil |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [58009] (7 PDB entries) |
![]() | Domain d1mz9e_: 1mz9 E: [79691] complex with vitamin D3 complexed with vdy |
PDB Entry: 1mz9 (more details), 1.7 Å
SCOPe Domain Sequences for d1mz9e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mz9e_ h.1.7.1 (E:) Assembly domain of cartilage oligomeric matrix protein {Norway rat (Rattus norvegicus) [TaxId: 10116]} mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
Timeline for d1mz9e_:
![]() Domains from other chains: (mouse over for more information) d1mz9a_, d1mz9b_, d1mz9c_, d1mz9d_ |