Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (22 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.7: Assembly domain of cartilage oligomeric matrix protein [58006] (1 family) |
Family h.1.7.1: Assembly domain of cartilage oligomeric matrix protein [58007] (1 protein) |
Protein Assembly domain of cartilage oligomeric matrix protein [58008] (1 species) pentameric coiled-coil |
Species Rat (Rattus norvegicus) [TaxId:10116] [58009] (3 PDB entries) |
Domain d1mz9c_: 1mz9 C: [79689] |
PDB Entry: 1mz9 (more details), 1.7 Å
SCOP Domain Sequences for d1mz9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mz9c_ h.1.7.1 (C:) Assembly domain of cartilage oligomeric matrix protein {Rat (Rattus norvegicus)} mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
Timeline for d1mz9c_:
View in 3D Domains from other chains: (mouse over for more information) d1mz9a_, d1mz9b_, d1mz9d_, d1mz9e_ |