SCOP 1.63: Domain d1mz9a_: 1mz9 A:

Lineage for d1mz9a_ (1mz9 A:)

1. Root: SCOP 1.63

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.7: Assembly domain of cartilage oligomeric matrix protein [58006] (1 family)

5. Family h.1.7.1: Assembly domain of cartilage oligomeric matrix protein [58007] (1 protein)

6. Protein Assembly domain of cartilage oligomeric matrix protein [58008] (1 species)
   pentameric coiled-coil

7. Species Rat (Rattus norvegicus) [TaxId:10116] [58009] (3 PDB entries)

8. Domain d1mz9a_: 1mz9 A: [79687]

Details for d1mz9a_

PDB Entry: 1mz9, 1.7 Å

PDB Description: storage function of comp:the crystal structure of the coiled-coil domain in complex with vitamin d3

SCOP Domain Sequences for d1mz9a_:

Sequence; same for both SEQRES and ATOM records:

>d1mz9a_ h.1.7.1 (A:) Assembly domain of cartilage oligomeric matrix protein {Rat (Rattus norvegicus)}
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac

Timeline for d1mz9a_:

• d1mz9a_ is new in SCOP 1.63
  
• d1mz9a_ appears in SCOP 1.65
  
• d1mz9a_ appears in the current release, SCOPe 2.08