Lineage for d1mz8d_ (1mz8 D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597354Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 597355Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 597356Family d.4.1.1: HNH-motif [54061] (2 proteins)
  6. 597357Protein DNase domain of colicin E7 [54062] (1 species)
  7. 597358Species Escherichia coli [TaxId:562] [54063] (5 PDB entries)
  8. 597360Domain d1mz8d_: 1mz8 D: [79686]
    Other proteins in same PDB: d1mz8a_, d1mz8c_
    complexed with po4, zn

Details for d1mz8d_

PDB Entry: 1mz8 (more details), 2 Å

PDB Description: crystal structures of the nuclease domain of cole7/im7 in complex with a phosphate ion and a zinc ion

SCOP Domain Sequences for d1mz8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mz8d_ d.4.1.1 (D:) DNase domain of colicin E7 {Escherichia coli}
rnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskd
pelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtp
krhidihrgk

SCOP Domain Coordinates for d1mz8d_:

Click to download the PDB-style file with coordinates for d1mz8d_.
(The format of our PDB-style files is described here.)

Timeline for d1mz8d_: