SCOP 1.73: Domain d1mz8b_: 1mz8 B:

Lineage for d1mz8b_ (1mz8 B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (2 proteins)

6. Protein DNase domain of colicin E7 [54062] (1 species)

7. Species Escherichia coli [TaxId:562] [54063] (6 PDB entries)

8. Domain d1mz8b_: 1mz8 B: [79684]
   Other proteins in same PDB: d1mz8a_, d1mz8c_

Details for d1mz8b_

PDB Entry: 1mz8, 2 Å

PDB Description: crystal structures of the nuclease domain of cole7/im7 in complex with a phosphate ion and a zinc ion

PDB Compounds: (B:) colicin e7

SCOP Domain Sequences for d1mz8b_:

Sequence; same for both SEQRES and ATOM records:

>d1mz8b_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
krnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevsk
dpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvt
pkrhidihrgk

Timeline for d1mz8b_:

• d1mz8b_ first appeared in SCOP 1.63
  
• d1mz8b_ appears in SCOP 1.71
  
• d1mz8b_ appears in SCOP 1.75
  
• d1mz8b_ appears in the current release, SCOPe 2.08