Lineage for d1mz8a_ (1mz8 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731061Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1731236Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) (S)
    automatically mapped to Pfam PF01320
  5. 1731237Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 1731238Protein ImmE7 protein (Im7) [47347] (1 species)
  7. 1731239Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)
  8. 1731247Domain d1mz8a_: 1mz8 A: [79683]
    Other proteins in same PDB: d1mz8b_, d1mz8d_
    complexed with po4, zn

Details for d1mz8a_

PDB Entry: 1mz8 (more details), 2 Å

PDB Description: crystal structures of the nuclease domain of cole7/im7 in complex with a phosphate ion and a zinc ion
PDB Compounds: (A:) colicin e7 immunity protein

SCOPe Domain Sequences for d1mz8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mz8a_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

SCOPe Domain Coordinates for d1mz8a_:

Click to download the PDB-style file with coordinates for d1mz8a_.
(The format of our PDB-style files is described here.)

Timeline for d1mz8a_: